PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS540524.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family bHLH
Protein Properties Length: 286aa    MW: 32144.7 Da    PI: 6.9012
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS540524.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH48.61.4e-1593145155
                   CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
           HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                   ++ +hn+ Er RR++iNs ++ Lr+llP+a   + +Kls  +++ ++ +YI +Lq
  EcS540524.10  93 KKLNHNACERDRRKKINSLYSALRSLLPSA--DQTEKLSIPATVSQVLKYIPELQ 145
                   6789*************************5..599*****************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088813.92992144IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000835.21E-1393149No hitNo description
SuperFamilySSF474592.49E-1693163IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.105.5E-1493164IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.1E-1293145IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003534.6E-1198150IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010106Biological Processcellular response to iron ion starvation
GO:0055072Biological Processiron ion homeostasis
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MITQLLMELK ISENSGKKKI VIQMLSCSPS NWPFEDSTSH EQENYMRRDA HPFSSPPPLH  60
FAFLSSPSPH AEVVLDHLNI PAAATNGEAT MVKKLNHNAC ERDRRKKINS LYSALRSLLP  120
SADQTEKLSI PATVSQVLKY IPELQQQVQI LAREREELLS RINATQGIDD CTHQEISKGK  180
GALSNPMPSI STNCLSESEV AIQICTTKVM TQNTVDFSEI LLNLDHHGFP LINASTFESF  240
GGTRTTFYNL HVQVERSRGM ECEALKEKLL ALYDQKGREV KFLIQH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010023785.10.0PREDICTED: transcription factor bHLH101-like
TrEMBLA0A059DH161e-178A0A059DH16_EUCGR; Uncharacterized protein
STRINGVIT_08s0007g05300.t013e-66(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48228153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.12e-40bHLH family protein